Nesfatin-1 (human) trifluoroacetate salt，CAS : 917528-35-9

Nesfatin-1 (human) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-991	50ug	350.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	917528-35-9
Sequence	VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL
Synonyms	Nucleobindin-2 (25-106) (human), NUCB2 (25-106) (human), DNA-Binding Protein NEFA (25-106) (human), Gastric Cancer Antigen Zg4 (25-106) (human)
Molecular Formula	C₄₂₇H₆₉₁N₁₁₃O₁₃₄
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document